PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00019.214
Common NameAMTR_s00019p00192190, LOC18435463
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family CO-like
Protein Properties Length: 391aa    MW: 42326.2 Da    PI: 6.0148
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00019.214genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.32e-054686438
                                  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Ht 38
                                              + C+ ++   + lfC+ ++ +lC  C    H g       H+
  evm_27.model.AmTr_v1.0_scaffold00019.214 46 KACEGCKATAALLFCRADSAFLCLGCDARVH-GanklasrHE 86
                                              67******99*****************9999.4466666676 PP

2zf-B_box24.65.4e-0888130339
                                  zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39 
                                                ++C+ +e+ +++  C+ +   lC  C   +H+       H++
  evm_27.model.AmTr_v1.0_scaffold00019.214  88 VWVCEVCEQAPASVTCKADAAALCVACDADIHSAnplarrHER 130
                                               689*****************************65777777775 PP

3CCT70.15.5e-24319362144
                                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                               Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  evm_27.model.AmTr_v1.0_scaffold00019.214 319 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 362
                                               9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.8E-104390IPR000315B-box-type zinc finger
PROSITE profilePS501199.8554390IPR000315B-box-type zinc finger
CDDcd000211.51E-74890No hitNo description
PROSITE profilePS5011910.60886133IPR000315B-box-type zinc finger
PfamPF006432.3E-687132IPR000315B-box-type zinc finger
CDDcd000211.19E-989133No hitNo description
SMARTSM003361.2E-991133IPR000315B-box-type zinc finger
PfamPF062036.1E-18319361IPR010402CCT domain
PROSITE profilePS5101716.787319361IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MSTANVSATT KPDSEPRGSG DAFSAPFAAQ FPGHEAPPSA PWSVAKACEG CKATAALLFC  60
RADSAFLCLG CDARVHGANK LASRHERVWV CEVCEQAPAS VTCKADAAAL CVACDADIHS  120
ANPLARRHER FPVVPFYEPP APKSSASCLL VPDRGPKTTE NAKLDDEDED DDHNSIGADE  180
AEAATWLLPN PKIGGGEMKS ADYFFPEVDP YLDLEYGSPV DQRFQAHNGT DSVVPVQSKG  240
MGNDQCLEFD FSRPKNGYSY TTASMSHSVS SSSLDVGVVP DGSAMTDISN PYSRTLKGGQ  300
DLVAHVPSQP SSHYPPMDRE ARVLRYREKR KNRKFEKTIR YASRKAYAET RPRIKGRFAK  360
RTDIEVEVDR IYSSAAALMA DTSYGIVPSF *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006845571.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4
SwissprotQ9FHH84e-97COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLW1PI080.0W1PI08_AMBTC; Uncharacterized protein
STRINGVIT_11s0052g01800.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.16e-78CONSTANS-like 4
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]